Proglucagon is a precursor of glucagon, and several other components. Glucagon is an important Hormone involved in Carbohydrate metabolism. It is generated in the alpha cells of the pancreas, and it consists of the following:
- Glicentin
- major proglucagon fragment (MPGF)
External links
Alpha cells are endocrine cells in the Islets of Langerhans of the Pancreas. The pancreas is a Gland organ in the digestive and Endocrine system of Vertebrates. Oxyntomodulin is a naturally occurring 37 amino acid peptide Hormone found in the colon, produced by the Oxyntic ( Fundic) cells of the oxyntic Glucagon is an important Hormone involved in Carbohydrate metabolism. Peptides (from the Greek πεπτίδια, "small digestibles" are short Polymers formed from the linking in a defined order of α- Amino Glucagon-like peptide-1 (GLP-1 is derived from the transcription product of the Proglucagon gene Glucagon-like peptide-2 (GLP-2 is a 33 Amino acid Peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans
© 2009 citizendia.org; parts available under the terms of GNU Free Documentation License, from http://en.wikipedia.org
network: | |
